Host taxon 10090
Protein NP_035829.1
protein lin-7 homolog C
Mus musculus
Gene Lin7c, UniProt O88952
>NP_035829.1|Pseudomona aeruginosa PA01|protein lin-7 homolog C
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.37 | 1.37386010000798 | 4.1e-54 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)