Host taxon 10090
Protein NP_001278215.1
protein Hikeshi isoform b
Mus musculus
Gene Hikeshi, UniProt Q9DD02
>NP_001278215.1|Pseudomona aeruginosa PA01|protein Hikeshi isoform b
MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGVPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.06 | -2.06015413456703 | 0.0001 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)