Host taxon 10090
Protein NP_001157264.1
protein FAM76A isoform B
Mus musculus
Gene Fam76a, UniProt Q922G2
>NP_001157264.1|Pseudomona aeruginosa PA01|protein FAM76A isoform B
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRGSHQEKEQYSRLSGGSHYNSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQTRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGTITSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.77 | 0.772130073584952 | 1.8e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)