Host taxon 10090
Protein NP_001028650.2
protein FAM47E isoform 1
Mus musculus
Gene Fam47e, UniProt B2RVF4
>NP_001028650.2|Pseudomona aeruginosa PA01|protein FAM47E isoform 1
MLSCIQPLPTLHFLCIIREHLACDCLPRCLSPSCIAEATQRPKKTLISRSGQWLCEEKSSKVDSLYKDRLLHDDVHRGVTDFCHWAEDLGSSAIEEEFVLQQFDIGYQTRRSCDALLRLRLNQDKLFINRPPSLREHCGHWSEPRSSGRANPQKPKRVKMRYGAWYLNTSLWKRQRADEPLVDPMVSHKAQDSTFKEQLQEQGELLAGLRGTAAFKDFILSRGYRMPRFLEKIYAEEKNKSENIKAPKKLTQTEKNPGSR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.48 | -1.4772313855294 | 0.021 | 32071273 | |
Retrieved 1 of 5 entries in 0.7 ms
(Link to these results)