Host taxon 10090
Protein NP_001300654.1
protein FAM3A isoform 1 precursor
Mus musculus
Gene Fam3a, UniProt Q9D8T0
>NP_001300654.1|Pseudomona aeruginosa PA01|protein FAM3A isoform 1 precursor
MRLAGPLRIVALIIIMGLTWILVTILLGGPGVGLPRIQQFFTSPENSVTAEPRARKYKCGLPQPCPEEHLSFRIVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELLEARAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKDLAFRDSWVFVGAKGVQNKSPFEQHMKNSKHTNKYEGWPEALEMEGCIPRRSIAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.68 | -1.67693191809563 | 7.4e-7 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)