Host taxon 10090
Protein NP_079902.1
protein FAM107B
Mus musculus
Gene Fam107b, UniProt Q3TGF2
>NP_079902.1|Pseudomona aeruginosa PA01|protein FAM107B
MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.72 | 1.72353261185119 | 1.2e-71 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)