Host taxon 10090
Protein NP_001158155.1
protein FAM104B isoform a
Mus musculus
Gene Tmem29, UniProt A2ANF5
>NP_001158155.1|Pseudomona aeruginosa PA01|protein FAM104B isoform a
MDPLQKWDPMSISVPSCIATVSSSQEASAAPQPSSSEKLSMGLSILSVSPSPRSSVPASLSEGLFQQQAREKKALWQQYWEKQGFPQRKKVFLRHSRRWHRDHMAPYLLERDLRGFPSGDKAQNQLRCQGHVQNIAGMSGQKNAAPNPPSWEMLVQGLNGLTLSLGANRPVPLPEEPWQQQEPEDMRQLERQQENLKMFQRMLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.03 | -1.03194912423259 | 0.04 | 32071273 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)