Host taxon 10090
Protein NP_742157.1
protein eva-1 homolog B
Mus musculus
Gene Eva1b, UniProt Q8K2Y3
>NP_742157.1|Pseudomona aeruginosa PA01|protein eva-1 homolog B
MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISCAPRSRPRTPAPRRDPRSSTLEPEDEDDEEDEDTMTRLGPDDTLQGQELSTEPDGPLSVNVFTSAEELERAQRLEERERILREIWRTGQPDLLGSGTLGPGATATLGRMHYY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.78 | -0.782041077159569 | 7.4e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)