Host taxon 10090
Protein NP_080976.1
protein dopey-2 isoform 2
Mus musculus
Gene Dop1b, UniProt Q3UHQ6
>NP_080976.1|Pseudomona aeruginosa PA01|protein dopey-2 isoform 2
MDPEEQELLNDYRYRSYSSVIEKALRNFESSSEWADLISSLGKLNKALQSNLKYSLLPRRLIISKRLAQCLHPALPSGVHLKALETYEIIFKIVGTKWLAKDLFLYSCGLFPLLAYAAMSVRPVLLGLYEKYFLPLQKLLLPSLQAFLVGLLPGLEEGSEIYERLVDIMSGLQALICRELVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.32 | 0.321553127069485 | 0.002 | 32071273 | |
Retrieved 1 of 3 entries in 1.8 ms
(Link to these results)