Host taxon 10090
Protein NP_080583.3
protein CutA isoform 1 precursor
Mus musculus
Gene Cuta, UniProt Q9CQ89
>NP_080583.3|Pseudomona aeruginosa PA01|protein CutA isoform 1 precursor
MNWGRAPGVLLGGGATLLLSFLWMPALLPVASRLLLLPRALLSMASGSPPSQPPPASGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTEFVRSVHPYEVAEVIALPVEQGNPPYLHWVHQVTESVSNSGTALP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.55 | -1.54734312807246 | 3.9e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)