Host taxon 10090
Protein NP_031822.2
protein CTLA-2-alpha isoform a precursor
Mus musculus
Gene Ctla2a, UniProt P12399
>NP_031822.2|Pseudomona aeruginosa PA01|protein CTLA-2-alpha isoform a precursor
MMVSICEQKLQHFSAVFLLILCLGMMSAAPPPDPSLDNEWKEWKTKFAKAYNLNEERHRRLVWEENKKKIEAHNADYEQGKTSFYMGLNQFSDLTPEEFKTNCYGNSLNRGEMAPDLPEYEDLGKNSYLTPGRAQPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.56 | 1.55649972888946 | 3.5e-55 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)