Host taxon 10090
Protein NP_034049.2
protein cornichon homolog 1 isoform 1
Mus musculus
Gene Cnih1, UniProt O35372
>NP_034049.2|Pseudomona aeruginosa PA01|protein cornichon homolog 1 isoform 1
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.82 | -0.822253952097092 | 0.00046 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)