Host taxon 10090
Protein NP_031596.1
protein BTG2
Mus musculus
Gene Btg2, UniProt Q04211
>NP_031596.1|Pseudomona aeruginosa PA01|protein BTG2
MSHGKRTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSRALQDALTDHYKHHWFPEKPSKGSGYRCIRINHKMDPIISKVASQIGLSQPQLHRLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPVAASYGLLTCKNQMMLGRSSPSKNYVMAVSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.59 | 0.588916273532273 | 6.3e-26 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)