Host taxon 10090
Protein NP_033879.1
protein BEX2
Mus musculus
Gene Bex2, UniProt Q9WTZ8
>NP_033879.1|Pseudomona aeruginosa PA01|protein BEX2
MESKVEQGVKNLNMENDHQEKEEKEEKPQDASKRDPIVALPFEAGDYYVPRGGRRRFRVRQPIVHYRWDLMHRVGEPQGRMREENVQRFGDDVRQLMEKLRERQLSHSLRAVSTDPPHHDHHDEFCLMP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.52 | -2.52018667406255 | 1.1e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)