Host taxon 10090
Protein NP_083907.3
protein ABHD14B
Mus musculus
Gene Abhd14b, UniProt E9QN99
>NP_083907.3|Pseudomona aeruginosa PA01|protein ABHD14B
MAGVDQHEGTIKVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEAGYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYGDQDPMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.37 | -2.36956309059274 | 1.3e-9 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)