Host taxon 10090
Protein NP_071860.1
prostaglandin E synthase
Mus musculus
Gene Ptges, UniProt Q9JM51
>NP_071860.1|Pseudomona aeruginosa PA01|prostaglandin E synthase
MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.19 | 2.19013100170341 | 3.7e-74 | 32071273 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)