Host taxon 10090
Protein NP_001032628.1
prokineticin-2 isoform 2 precursor
Mus musculus
Gene Prok2, UniProt Q9QXU7
>NP_001032628.1|Pseudomona aeruginosa PA01|prokineticin-2 isoform 2 precursor
MGDPRCAPLLLLLLLPLLFTPPAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6.31 | 6.31090055694108 | 1.6e-7 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)