Host taxon 10090
Protein NP_034545.1
proheparin-binding EGF-like growth factor precursor
Mus musculus
Gene Hbegf, UniProt Q06186
>NP_034545.1|Pseudomona aeruginosa PA01|proheparin-binding EGF-like growth factor precursor
MKLLPSVMLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGSTNQLLPTGGDRAQGVQDLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGVASSH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.75 | 2.74798622985325 | 5.8e-124 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)