Host taxon 10090
Protein NP_941011.1
probable ribosome biogenesis protein RLP24
Mus musculus
Gene Rsl24d1, UniProt Q99L28
>NP_941011.1|Pseudomona aeruginosa PA01|probable ribosome biogenesis protein RLP24
MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPVKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEEAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.05 | 1.04536624369549 | 3.4e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)