Host taxon 10090
Protein NP_001334368.1
probable global transcription activator SNF2L2 isoform 3 precursor
Mus musculus
Gene Smarca2, UniProt Q6DIC0
>NP_001334368.1|Pseudomona aeruginosa PA01|probable global transcription activator SNF2L2 isoform 3 precursor
MKRLAARCFAGLLILSPLTVISDSRPADSGKAIEDGNLEEMEEEVRLKKRKRRRNVDKDPVKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKDLPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEEESNEEEEEDDEEESESEAKSVKVKIKLNKKEEKGRDTGKGKKRPNRGKAKPVVSDFDSDEEQEENEQSEASGTDNE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.92 | -0.923546112581147 | 1.7e-30 | 32071273 | |
Retrieved 1 of 5 entries in 1.2 ms
(Link to these results)