Host taxon 10090
Protein NP_067421.1
probable ergosterol biosynthetic protein 28 isoform 1
Mus musculus
Gene Erg28, UniProt Q9ERY9
>NP_067421.1|Pseudomona aeruginosa PA01|probable ergosterol biosynthetic protein 28 isoform 1
MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVFGTAAPTVGVLAPLMVASFSILGMLVGLRYLEAEPVSRQKKRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.02 | -2.02021542844647 | 4.6e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)