Bacterial taxon 208964
Protein WP_003095194.1
preprotein translocase subunit SecG
Pseudomona aeruginosa PA01
Gene secG, UniProt Q9HV52
>WP_003095194.1|Pseudomona aeruginosa PA01|preprotein translocase subunit SecG
MLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILAAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAGDVPAAPEQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.24 | 0.235983661702023 | 0.00088 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)