Host taxon 10090
Protein NP_035200.2
prefoldin subunit 2 isoform 1
Mus musculus
Gene Pfdn2, UniProt O70591
>NP_035200.2|Pseudomona aeruginosa PA01|prefoldin subunit 2 isoform 1
MADSSGRVGKSGGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.54 | 1.54190580624646 | 0.00048 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)