Host taxon 10090
Protein NP_001292062.1
predicted gene 14296 isoform 2
Mus musculus
Gene 2210418O10Rik, UniProt D3YYR3
>NP_001292062.1|Pseudomona aeruginosa PA01|predicted gene 14296 isoform 2
MLETYRNLTAIGYIWEEHTIEDHFQTSRSHGRHERSCTAEQPSEFIQCGKAFAYESHSQMHQIKHTGEKHYDCNQCGKAFKRRSDLQIHKRTHTGEKPYECK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -5.53 | -5.53428928463507 | 0.032 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)