Host taxon 10090
Protein NP_001191986.1
predicted gene 14295
Mus musculus
Gene Gm14295, UniProt A2BG90
>NP_001191986.1|Pseudomona aeruginosa PA01|predicted gene 14295
MDLVTYDDVQVNFTQDEWALLDPSQKSLYKGVMLETYRNLTAIGYIWEEHTIEDHFQTSRSHGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.12 | -3.12479307357649 | 7.0e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)