Host taxon 10090
Protein NP_780355.2
pre-rRNA-processing protein TSR2 homolog isoform 2
Mus musculus
Gene Tsr2, UniProt Q8C8T8
>NP_780355.2|Pseudomona aeruginosa PA01|pre-rRNA-processing protein TSR2 homolog isoform 2
MMAGAAEDVRVLFGAAVRAALEAWPALQIAVENGFGGVHSQEKAEWLGGAVEDYFIANADLELEEIEDFLGELMTTEFDTVVEDGSLPQVSQQLQTMFHHFQKGDGAALQEMTSQINQKKCKVTATPLMTAKETDVAEDDVDSVEEMEVTATNDGATTDEVCPQPQPSDPDTQTIKEEDIVEDGWTIVRRKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.94 | 0.939324583352496 | 0.0015 | 32071273 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)