Host taxon 10090
Protein NP_001107004.1
pre-mRNA-splicing regulator WTAP isoform b
Mus musculus
Gene Wtap, UniProt Q9ER69
>NP_001107004.1|Pseudomona aeruginosa PA01|pre-mRNA-splicing regulator WTAP isoform b
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.61 | 0.607927081175602 | 2.3e-8 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)