Host taxon 10090
Protein NP_075368.1
PRA1 family protein 3
Mus musculus
Gene Arl6ip5, UniProt Q8R5J9
>NP_075368.1|Pseudomona aeruginosa PA01|PRA1 family protein 3
MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNMILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVMVFVFGITLPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDNINKFADYISKARE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.39 | 0.389665689896623 | 0.0031 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)