Host taxon 10090
Protein NP_780638.1
potassium channel tetramerisation domain containing 12b
Mus musculus
Gene Kctd12b, UniProt Q8C7J6
>NP_780638.1|Pseudomona aeruginosa PA01|potassium channel tetramerisation domain containing 12b
MAMPEKSSDVKPTEECGSFPEIIELNVGGQVYITRYPTLISIPGSRLWEMFSVKNPCSLIQDNKGRFFIDRDGFLFRYVLDYMRDMQVVLPDHFPECGRLHREAEYFKLPELAKMLAPKMNKLNSIGNDSCPIDLEELSPSIDTTFNFSSTNSIHISGPDNPMVLRAAPGSELKKAGFITIGYRGSYTLGRDSQADAKFRRVARIMVCGKISLAKEVFGDTLNESRDPDRPPERYTSRYYLKFTFLEQAFDKLADAGFHMVACNSTGTCTVTHDQTDDRIWTSYTEYVFYRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.07 | -3.07284804954449 | 2.4e-18 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)