Host taxon 10090
Protein NP_666281.2
polyadenylate-binding protein-interacting protein 2B
Mus musculus
Gene Paip2b, UniProt Q91W45
>NP_666281.2|Pseudomona aeruginosa PA01|polyadenylate-binding protein-interacting protein 2B
MTTLNTGSARISIMNGSSVASTSPSVKCKEDQGLNGHEEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRCFQEMLDEEDQDWFIPARDLPQAVGHLQQQLNGLSVGDSHESEDILSKSNLNPDAKEFVPGVKY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.61 | 0.607255402228522 | 0.00054 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)