Host taxon 10090
Protein NP_035187.2
platelet-derived growth factor subunit B precursor
Mus musculus
Gene Pdgfb, UniProt P31240
>NP_035187.2|Pseudomona aeruginosa PA01|platelet-derived growth factor subunit B precursor
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLGA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.6 | -0.601106739596267 | 2.5e-8 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)