Host taxon 10090
Protein NP_032834.1
platelet-derived growth factor subunit A isoform 1 precursor
Mus musculus
Gene Pdgfa, UniProt P20033
>NP_032834.1|Pseudomona aeruginosa PA01|platelet-derived growth factor subunit A isoform 1 precursor
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALETSLRAHGSHAINHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.86 | -0.861883358116376 | 4.5e-9 | 32071273 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)