Host taxon 10090
Protein NP_032802.1
platelet-activating factor acetylhydrolase IB subunit gamma
Mus musculus
Gene Pafah1b3, UniProt Q61205
>NP_032802.1|Pseudomona aeruginosa PA01|platelet-activating factor acetylhydrolase IB subunit gamma
MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.71 | -1.70676091446531 | 0.0034 | 32071273 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)