Host taxon 10090
Protein NP_032801.2
platelet-activating factor acetylhydrolase IB subunit beta isoform d
Mus musculus
Gene Pafah1b2, UniProt Q61206
>NP_032801.2|Pseudomona aeruginosa PA01|platelet-activating factor acetylhydrolase IB subunit beta isoform d
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.32 | 0.322505077619622 | 0.0069 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)