Host taxon 10090
Protein NP_631937.1
placenta-specific gene 8 protein
Mus musculus
Gene Plac8, UniProt Q9JI48
>NP_631937.1|Pseudomona aeruginosa PA01|placenta-specific gene 8 protein
MAQAPTVIVTQPGFVRAPQNSNWQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECCLCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMNAF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.5 | 1.49584286472246 | 1.0e-9 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)