Host taxon 10090
Protein NP_666037.1
pituitary tumor-transforming gene 1 protein-interacting protein precursor
Mus musculus
Gene Pttg1ip, UniProt Q8R143
>NP_666037.1|Pseudomona aeruginosa PA01|pituitary tumor-transforming gene 1 protein-interacting protein precursor
MAPANLGLTPHWVMLLGAVLLLLLSGASAQEPPRVGCSEYTNRSCEECLRNVSCLWCNENKACMDYPVRKILPPASLCKLSSARWGVCWVNFEALIITMSVLGGSVLLGITVCCCYCCRRKKSRKPDKSDERAMREQEERRVRQEERRAEMKSRHDEIRKKYGLFKEQNPYEKF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.02 | 1.01510386052091 | 8.5e-45 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)