Host taxon 10090
Protein NP_001297569.1
phosphomevalonate kinase isoform 3
Mus musculus
Gene Pmvk, UniProt Q9D1G2
>NP_001297569.1|Pseudomona aeruginosa PA01|phosphomevalonate kinase isoform 3
MICWGEQKRQADPGFFCRKIVEGVSQPIWLVSDTRRTSDIQWFQEAYGAVIQTVRVVASEQSRQQRGWVFTPGVDDAESECGLDNFGNFDWVIENHGDEQCLEDQLEHLLGFIQAKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.33 | 2.32872506384644 | 8.3e-28 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)