Host taxon 10090
Protein NP_038900.1
phosphomannomutase 1 isoform 1
Mus musculus
Gene Pmm1, UniProt O35621
>NP_038900.1|Pseudomona aeruginosa PA01|phosphomannomutase 1 isoform 1
MAVAVEGARRKERILCLFDVDGTLTPARQKIDPEVSAFLQKLRSRVQIGVVGGSDYSKIAEQLGEGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNETSPGGNDFEIYADPRTVGHSVVSPQDTVQRCRELFFPETAHEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.13 | -1.12672757722058 | 0.044 | 32071273 | |
Retrieved 1 of 3 entries in 2.2 ms
(Link to these results)