Host taxon 10090
Protein NP_001032830.2
phospholipid hydroperoxide glutathione peroxidase isoform B
Mus musculus
Gene Gpx4, UniProt O70325
>NP_001032830.2|Pseudomona aeruginosa PA01|phospholipid hydroperoxide glutathione peroxidase isoform B
MGRAAARKRGRCRQRGGSPRGRRRRGPGRQSPRKRPGPRRRKARARRRRRARPRRMEPIPEPFNPGPLLQEPPQYCNSSEFLGLCASRDDWRCARSMHEFSAKDIDGHMVCLDKYRGFVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFAAGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDLPCYL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.43 | -0.431051433224994 | 0.0019 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)