Host taxon 10090
Protein NP_644675.2
phospholipase A and acyltransferase 3
Mus musculus
Gene Plaat3, UniProt Q8R3U1
>NP_644675.2|Pseudomona aeruginosa PA01|phospholipase A and acyltransferase 3
MLAPIPEPKPGDLIEIFRPMYRHWAIYVGDGYVIHLAPPSEIAGAGAASIMSALTDKAIVKKELLCHVAGKDKYQVNNKHDEEYTPLPLSKIIQRAERLVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKAVGIAGVGLAALGLVGVMLSRNKKQKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.63 | -0.633902375773533 | 0.043 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)