Host taxon 10090
Protein NP_001288573.1
phosphatidylinositol transfer protein beta isoform isoform 3
Mus musculus
Gene Pitpnb, UniProt P53811
>NP_001288573.1|Pseudomona aeruginosa PA01|phosphatidylinositol transfer protein beta isoform isoform 3
MIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLGPNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.94 | 0.942684910991841 | 8.2e-10 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)