Bacterial taxon 208964
Protein WP_003117657.1
phenazine biosynthesis protein PhzA 2
Pseudomona aeruginosa PA01
Gene phzA2, UniProt Q9I2J9
>WP_003117657.1|Pseudomona aeruginosa PA01|phenazine biosynthesis protein PhzA 2
MREYQRLKGFTDNLELRRRNRATVEHYMRMKGAERLQRHSLFVEDGCAGNWTTESGEPLVFRGHESLRRLAEWLERCFPDWEWHNVRIFETEDPNHFWVECDGRGKALVPGYPQGYCENHYIHSFELENGRIKRNREFMNPMQKLRALGIAVPQIKRDGIPT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -4.63 | -4.63409064166192 | 1.5e-13 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)