Host taxon 10090
Protein NP_081013.1
PHD finger-like domain-containing protein 5A
Mus musculus
Gene Phf5a, UniProt P83870
>NP_081013.1|Pseudomona aeruginosa PA01|PHD finger-like domain-containing protein 5A
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.69 | 0.69374244994962 | 0.0086 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)