Host taxon 10090
Protein NP_067509.1
peroxisomal membrane protein 4
Mus musculus
Gene Pxmp4, UniProt Q9JJW0
>NP_067509.1|Pseudomona aeruginosa PA01|peroxisomal membrane protein 4
MAAPPQLQALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRAPHALVMTFLFRSGSLREKLQAILKATYIHSRNLACFVFAYKSLHALQSHVQGETHQMHSFLAAFIGGLLLFGENNNINSQINMYLTSRVLYALCRLGVEKGYIPALKWDPFPLHTAVIWGLVLWLFEYHRPTLQPSLQSSMTYLYEDSNVWHDLSDFLIFNKSHPSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.51 | -2.50830022616995 | 1.2e-16 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)