Host taxon 10090
Protein NP_033019.2
peroxisomal membrane protein 2
Mus musculus
Gene Pxmp2, UniProt P42925
>NP_033019.2|Pseudomona aeruginosa PA01|peroxisomal membrane protein 2
MAPAASRLRVESELGSLPKRALAQYLLLLKLYPVLTKAVSSGILSALGNLLAQTIEKRKKDSQNLEVSGLLRYLVYGLFVTGPLSHYLYLFMEYSVPPEVPWASVKRLLLDRLFFAPTFLLLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFANMAALFWYAYLASLGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.79 | -1.78951265688199 | 0.0038 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)