Host taxon 10090
Protein NP_031479.1
peroxiredoxin-6 isoform 1
Mus musculus
Gene Prdx6, UniProt O08709
>NP_031479.1|Pseudomona aeruginosa PA01|peroxiredoxin-6 isoform 1
MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDANNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.12 | 1.12162580770066 | 2.1e-119 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)