Host taxon 10090
Protein NP_036151.1
peroxiredoxin-5, mitochondrial isoform 1 precursor
Mus musculus
Gene Prdx5, UniProt P99029
>NP_036151.1|Pseudomona aeruginosa PA01|peroxiredoxin-5, mitochondrial isoform 1 precursor
MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.1 | 2.09562386449982 | 1.4e-77 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)