Bacterial taxon 208964
Protein WP_003083828.1
peroxiredoxin
Pseudomona aeruginosa PA01
Gene ahpC, UniProt Q9I6Z3
>WP_003083828.1|Pseudomona aeruginosa PA01|peroxiredoxin
MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTFNCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQLTNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPGEVCPAKWKEGEKTLAPSLDLVGKI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.26 | 0.259951628409483 | 1.2e-6 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)