Host taxon 10090
Protein NP_001289184.1
peripheral myelin protein 22 isoform 1
Mus musculus
Gene Pmp22, UniProt P16646
>NP_001289184.1|Pseudomona aeruginosa PA01|peripheral myelin protein 22 isoform 1
MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHTTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLALFLFFCQLFTLTKGGRFYITGFFQILAGLCVMSAAAIYTVRHSEWHVNTDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.22 | -0.221378003033293 | 0.00095 | 32071273 | |
Retrieved 1 of 2 entries in 2.3 ms
(Link to these results)