Host taxon 10090
Protein NP_001092280.1
peptidyl-tRNA hydrolase 2, mitochondrial isoform b
Mus musculus
Gene Ptrh2, UniProt Q8R2Y8
>NP_001092280.1|Pseudomona aeruginosa PA01|peptidyl-tRNA hydrolase 2, mitochondrial isoform b
MLSKFLTMEYLVHPGTLSLAAGVACGMCLGWGLRSHLGMFPQNSTSEANRDTETGTEASILGESGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRSPQVLKEWEYCGQPKVVVKAPDEDTLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLGIGPGPVELIDEVTGHLKLY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.36 | 1.36243611104289 | 1.5e-10 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)